PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040135.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 325aa    MW: 37238.3 Da    PI: 6.448
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040135.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.75.6e-5451331128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eelv +yLk+k+++ +++l +vi ++d+yk+ePwd+++     ++e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+vls 
  Pbr040135.1   5 VPPGFRFHPTEEELVGYYLKRKINSLHIDL-DVIVDIDLYKIEPWDIQArcrLGYSEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKAVLS- 100
                  69****************************.99**************953543344778**************************************. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  k++ +g++ktLvfykgrap+g+ktdW+mheyrl
  Pbr040135.1 101 KDNIIGMRKTLVFYKGRAPNGNKTDWIMHEYRL 133
                  8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.23E-583169IPR003441NAC domain
PROSITE profilePS5100557.15169IPR003441NAC domain
PfamPF023651.2E-286133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009735Biological Processresponse to cytokinin
GO:0009737Biological Processresponse to abscisic acid
GO:0009741Biological Processresponse to brassinosteroid
GO:0045491Biological Processxylan metabolic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:0050832Biological Processdefense response to fungus
GO:0071365Biological Processcellular response to auxin stimulus
GO:0090059Biological Processprotoxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MESCVPPGFR FHPTEEELVG YYLKRKINSL HIDLDVIVDI DLYKIEPWDI QARCRLGYSE  60
QNEWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKAVLS KDNIIGMRKT LVFYKGRAPN  120
GNKTDWIMHE YRLQTSEHAP PQASSSTSEM PSLNPKPEEG WVVCRAFKKP SPSHRQGFEA  180
WKHAYVRDHP SSSNFSSEIP MVINPNQGFH QSFGSEEDHF VSNNIFLGNQ LMELPQLESP  240
TISTSFVTKE NVLRSNNIST DDYEAERSNN NSSNQHIDWR NLDNLLEVQL TDRASFSHPS  300
LSSASQNYEQ ETQNNHLLGC FQDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-48216912168Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00017PBMTransfer from AT1G71930Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ9199620.0KJ919962.1 Eriobotrya japonica NAC1 transcription factor (NAC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009345934.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9C8W91e-114NAC30_ARATH; NAC domain-containing protein 30
TrEMBLA0A0H3VAL90.0A0A0H3VAL9_9R
STRINGPOPTR_0019s11330.11e-138(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF71383247
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71930.14e-94vascular related NAC-domain protein 7